Instructions to use nferruz/ProtGPT2 with libraries, inference providers, notebooks, and local apps. Follow these links to get started.
- Libraries
- Transformers
How to use nferruz/ProtGPT2 with Transformers:
# Use a pipeline as a high-level helper from transformers import pipeline pipe = pipeline("text-generation", model="nferruz/ProtGPT2")# Load model directly from transformers import AutoTokenizer, AutoModelForCausalLM tokenizer = AutoTokenizer.from_pretrained("nferruz/ProtGPT2") model = AutoModelForCausalLM.from_pretrained("nferruz/ProtGPT2", device_map="auto") - Notebooks
- Google Colab
- Kaggle
- Local Apps Settings
- vLLM
How to use nferruz/ProtGPT2 with vLLM:
Install from pip and serve model
# Install vLLM from pip: pip install vllm # Start the vLLM server: vllm serve "nferruz/ProtGPT2" # Call the server using curl (OpenAI-compatible API): curl -X POST "http://localhost:8000/v1/completions" \ -H "Content-Type: application/json" \ --data '{ "model": "nferruz/ProtGPT2", "prompt": "Once upon a time,", "max_tokens": 512, "temperature": 0.5 }'Use Docker
docker model run hf.co/nferruz/ProtGPT2
- SGLang
How to use nferruz/ProtGPT2 with SGLang:
Install from pip and serve model
# Install SGLang from pip: pip install sglang # Start the SGLang server: python3 -m sglang.launch_server \ --model-path "nferruz/ProtGPT2" \ --host 0.0.0.0 \ --port 30000 # Call the server using curl (OpenAI-compatible API): curl -X POST "http://localhost:30000/v1/completions" \ -H "Content-Type: application/json" \ --data '{ "model": "nferruz/ProtGPT2", "prompt": "Once upon a time,", "max_tokens": 512, "temperature": 0.5 }'Use Docker images
docker run --gpus all \ --shm-size 32g \ -p 30000:30000 \ -v ~/.cache/huggingface:/root/.cache/huggingface \ --env "HF_TOKEN=<secret>" \ --ipc=host \ lmsysorg/sglang:latest \ python3 -m sglang.launch_server \ --model-path "nferruz/ProtGPT2" \ --host 0.0.0.0 \ --port 30000 # Call the server using curl (OpenAI-compatible API): curl -X POST "http://localhost:30000/v1/completions" \ -H "Content-Type: application/json" \ --data '{ "model": "nferruz/ProtGPT2", "prompt": "Once upon a time,", "max_tokens": 512, "temperature": 0.5 }' - Docker Model Runner
How to use nferruz/ProtGPT2 with Docker Model Runner:
docker model run hf.co/nferruz/ProtGPT2
End-to-end example for AA sequence vectorization
Hello,
Thank you for wonderful research.
Would you like to share end-to-end example of AA sequence vectorization using ProtGPT2?
Including ProtGPT2 model and tokenizer loading and execution, sth like:
from transformers import AutoModelForCausalLM, AutoTokenizer
model_name = "nferruz/ProtGPT2"
model = AutoModelForCausalLM.from_pretrained(model_name).to('cuda:0')
tokenizer = AutoTokenizer.from_pretrained(model_name)
protein_sequences = [
"MINDLLDISRIISGKMTLDRAEVNLTAIARQVVEEQRQAAEAKSIQLLCSTPDTNHYVFG",
(...)
]
input_ids = tokenizer(protein_sequences, return_tensors="pt").to('cuda:0')
outputs = model(**input_ids)
(...)
Furthermore, it would be perfect to show how to handle output to get fixed length numeric vector for each protein.
This example could help other researchers to compare vector space of the proteins with other embeddings like ProtTrans or ESM.
Regards,
Piotr
Hi Piotr,
Thanks a lot for reaching out!
I haven't explored sequence embedding myself yet, since I trained ProtGTP2 with protein design in mind, but I'd love to see how it performs.
But, from the original GPT paper (although it wasn't explored in the GPT2 and GPT3 papers), it should be possible to embed the sequences by taking as a vector the attention heads.
Following your code, you could do:
outputs = model(input_ids, output_attentions=True)
This returns a dictionary with keys loss, logits, past_key_values, and attentions.
The attention tensor will have a shape (batch_size, num_heads, sequence_length, sequence_length),
in your case: torch.Size([1, 20, 21, 21]).
It is 21 because your 60 amino acid long sequence gets converted to a 21 token-long sequence.
This will be a problem if you want vectors of the same length after mutating a single amino acid because the number of tokens could change.
I hope this helps for now, but in the meanwhile, I'm going to try to read how to do this with autoregressive models in HuggingFace. I'll get back to you; sorry that I do not have hands-on experience to show!
Noelia